PDB entry 1c8u

View 1c8u on RCSB PDB site
Description: crystal structure of the e.coli thioesterase ii, a homologue of the human nef-binding enzyme
Deposited on 1999-07-29, released 2000-07-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8uA (A:)
    sqalknlltllnlekieeglfrgqsedlglrqvfggqvvgqalyaaketvpeerlvhsfh
    syflrpgdskkpiiydvetlrdgnsfsarrvaaiqngkpifymtasfqapeagfehqktm
    psapapdglpsetqiaqslahllppvlkdkficdrplevrpvefhnplkghvaephrqvw
    irangsvpddlrvhqyllgyasdlnflpvalqphgigflepgiqiatidhsmwfhrpfnl
    newllysvestsassargfvrgefytqdgvlvastvqegvmrnhn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c8uB (B:)
    sqalknlltllnlekieeglfrgqsedlglrqvfggqvvgqalyaaketvpeerlvhsfh
    syflrpgdskkpiiydvetlrdgnsfsarrvaaiqngkpifymtasfqapeagfehqktm
    psapapdglpsetqiaqslahllppvlkdkficdrplevrpvefhnplkghvaephrqvw
    irangsvpddlrvhqyllgyasdlnflpvalqphgigflepgiqiatidhsmwfhrpfnl
    newllysvestsassargfvrgefytqdgvlvastvqegvmrnhn