| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (25 species) not a true protein |
| Species Neisseria gonorrhoeae [TaxId:485] [365812] (2 PDB entries) |
| Domain d6qkna2: 6qkn A:171-329 [381049] automated match to d1zzha2 complexed with azi, ca, hec |
PDB Entry: 6qkn (more details), 2.3 Å
SCOPe Domain Sequences for d6qkna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qkna2 a.3.1.0 (A:171-329) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tkwdeylkgnvnalseqerkgvrafmdngciachngvnlggttfqkfglvqgpywkfied
pkrdkgradvtkktedefffrvpglrnvaktypyfhngsvweldkavtimgkaqlgkdip
kedvdnivvflnalsgnvsesartmpelpltapmeskpd
Timeline for d6qkna2: