|  | Class a: All alpha proteins [46456] (290 folds) | 
|  | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened | 
|  | Superfamily a.3.1: Cytochrome c [46626] (9 families)  covalently-bound heme completes the core | 
|  | Family a.3.1.0: automated matches [191374] (1 protein) not a true family | 
|  | Protein automated matches [190453] (26 species) not a true protein | 
|  | Species Neisseria gonorrhoeae [TaxId:485] [365812] (2 PDB entries) | 
|  | Domain d6qkna2: 6qkn A:171-329 [381049] automated match to d1zzha2 complexed with azi, ca, hec | 
PDB Entry: 6qkn (more details), 2.3 Å
SCOPe Domain Sequences for d6qkna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qkna2 a.3.1.0 (A:171-329) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tkwdeylkgnvnalseqerkgvrafmdngciachngvnlggttfqkfglvqgpywkfied
pkrdkgradvtkktedefffrvpglrnvaktypyfhngsvweldkavtimgkaqlgkdip
kedvdnivvflnalsgnvsesartmpelpltapmeskpd
Timeline for d6qkna2: