Lineage for d6qkna2 (6qkn A:171-329)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691681Species Neisseria gonorrhoeae [TaxId:485] [365812] (2 PDB entries)
  8. 2691687Domain d6qkna2: 6qkn A:171-329 [381049]
    automated match to d1zzha2
    complexed with azi, ca, hec

Details for d6qkna2

PDB Entry: 6qkn (more details), 2.3 Å

PDB Description: structure of the azide-inhibited form of cytochrome c peroxidase from obligate human pathogenic bacterium neisseria gonorrhoeae
PDB Compounds: (A:) Cytochrome-c peroxidase

SCOPe Domain Sequences for d6qkna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qkna2 a.3.1.0 (A:171-329) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tkwdeylkgnvnalseqerkgvrafmdngciachngvnlggttfqkfglvqgpywkfied
pkrdkgradvtkktedefffrvpglrnvaktypyfhngsvweldkavtimgkaqlgkdip
kedvdnivvflnalsgnvsesartmpelpltapmeskpd

SCOPe Domain Coordinates for d6qkna2:

Click to download the PDB-style file with coordinates for d6qkna2.
(The format of our PDB-style files is described here.)

Timeline for d6qkna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6qkna1