Lineage for d6qkna1 (6qkn A:1-170)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305126Species Neisseria gonorrhoeae [TaxId:485] [365812] (2 PDB entries)
  8. 2305131Domain d6qkna1: 6qkn A:1-170 [381048]
    automated match to d1zzha1
    complexed with azi, ca, hec

Details for d6qkna1

PDB Entry: 6qkn (more details), 2.3 Å

PDB Description: structure of the azide-inhibited form of cytochrome c peroxidase from obligate human pathogenic bacterium neisseria gonorrhoeae
PDB Compounds: (A:) Cytochrome-c peroxidase

SCOPe Domain Sequences for d6qkna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qkna1 a.3.1.0 (A:1-170) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
mgedqdllkraqgvfqplptveemqkirpfteeqvklghqlwyeprlskgntvscnschn
lasagvdnmptsqghkgqfggrnsptalnaallgsqfwdgraadveeqaggplvnpvema
ndsqeaaaakiakvpeyqemfkkafpedgavsfknittalgafertlltp

SCOPe Domain Coordinates for d6qkna1:

Click to download the PDB-style file with coordinates for d6qkna1.
(The format of our PDB-style files is described here.)

Timeline for d6qkna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6qkna2