SCOPe 2.07: Domain d6qknb1: 6qkn B:3-170

Lineage for d6qknb1 (6qkn B:3-170)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (25 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [365812] (2 PDB entries)

8. Domain d6qknb1: 6qkn B:3-170 [381122]
   automated match to d1zzha1
   complexed with azi, ca, hec

Details for d6qknb1

PDB Entry: 6qkn, 2.3 Å

PDB Description: structure of the azide-inhibited form of cytochrome c peroxidase from obligate human pathogenic bacterium neisseria gonorrhoeae

PDB Compounds: (B:) Cytochrome-c peroxidase

SCOPe Domain Sequences for d6qknb1:

Sequence; same for both SEQRES and ATOM records:

>d6qknb1 a.3.1.0 (B:3-170) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
edqdllkraqgvfqplptveemqkirpfteeqvklghqlwyeprlskgntvscnschnla
sagvdnmptsqghkgqfggrnsptalnaallgsqfwdgraadveeqaggplvnpvemand
sqeaaaakiakvpeyqemfkkafpedgavsfknittalgafertlltp

Timeline for d6qknb1:

• d6qknb1 is new in SCOPe 2.07-stable
  
• d6qknb1 appears in the current release, SCOPe 2.08