Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Akkermansia muciniphila [TaxId:239935] [380639] (1 PDB entry) |
Domain d6khxj1: 6khx J:1-207 [380695] Other proteins in same PDB: d6khxa2, d6khxb2, d6khxc2, d6khxd2, d6khxe2, d6khxf2, d6khxg2, d6khxh2, d6khxi2, d6khxj2 automated match to d3tkpe_ complexed with ca |
PDB Entry: 6khx (more details), 2.58 Å
SCOPe Domain Sequences for d6khxj1:
Sequence, based on SEQRES records: (download)
>d6khxj1 c.47.1.0 (J:1-207) automated matches {Akkermansia muciniphila [TaxId: 239935]} mlligkpaphfsanavvngtivpdfsldqfkgkkyvilffypkdftfvcpteligfqeal gefdkrdvavvgcstdsefshwawvntprdqggiqgvsypivsdinktisadygvlagde eidedgnvevngeliayrglflidkdgivrhqlindfplgrsideairvvdalqhfelyg evcplgwhkgeaamtpshegvasylsk
>d6khxj1 c.47.1.0 (J:1-207) automated matches {Akkermansia muciniphila [TaxId: 239935]} mlligkpaphfsanavvngtivpdfsldqfkgkkyvilffypkdftfvcpteligfqeal gefdkrdvavvgcstdsefshwawvntprdqggiqgvsypivsdinktisadygvlagde einvevngeliayrglflidkdgivrhqlindfplgrsideairvvdalqhfelygevcp lgwhkgeaamtpshegvasylsk
Timeline for d6khxj1: