![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein automated matches [190100] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries) |
![]() | Domain d3tkpe_: 3tkp E: [249928] automated match to d1qmva_ |
PDB Entry: 3tkp (more details), 2.49 Å
SCOPe Domain Sequences for d3tkpe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tkpe_ c.47.1.10 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse tiipdpagklkyfdkl
Timeline for d3tkpe_:
![]() Domains from other chains: (mouse over for more information) d3tkpa_, d3tkpb_, d3tkpc_, d3tkpd_ |