Lineage for d6khxj1 (6khx J:1-207)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2486910Species Akkermansia muciniphila [TaxId:239935] [380639] (1 PDB entry)
  8. 2486920Domain d6khxj1: 6khx J:1-207 [380695]
    Other proteins in same PDB: d6khxa2, d6khxb2, d6khxc2, d6khxd2, d6khxe2, d6khxf2, d6khxg2, d6khxh2, d6khxi2, d6khxj2
    automated match to d3tkpe_
    complexed with ca

Details for d6khxj1

PDB Entry: 6khx (more details), 2.58 Å

PDB Description: crystal structure of prx from akkermansia muciniphila
PDB Compounds: (J:) peroxiredoxin

SCOPe Domain Sequences for d6khxj1:

Sequence, based on SEQRES records: (download)

>d6khxj1 c.47.1.0 (J:1-207) automated matches {Akkermansia muciniphila [TaxId: 239935]}
mlligkpaphfsanavvngtivpdfsldqfkgkkyvilffypkdftfvcpteligfqeal
gefdkrdvavvgcstdsefshwawvntprdqggiqgvsypivsdinktisadygvlagde
eidedgnvevngeliayrglflidkdgivrhqlindfplgrsideairvvdalqhfelyg
evcplgwhkgeaamtpshegvasylsk

Sequence, based on observed residues (ATOM records): (download)

>d6khxj1 c.47.1.0 (J:1-207) automated matches {Akkermansia muciniphila [TaxId: 239935]}
mlligkpaphfsanavvngtivpdfsldqfkgkkyvilffypkdftfvcpteligfqeal
gefdkrdvavvgcstdsefshwawvntprdqggiqgvsypivsdinktisadygvlagde
einvevngeliayrglflidkdgivrhqlindfplgrsideairvvdalqhfelygevcp
lgwhkgeaamtpshegvasylsk

SCOPe Domain Coordinates for d6khxj1:

Click to download the PDB-style file with coordinates for d6khxj1.
(The format of our PDB-style files is described here.)

Timeline for d6khxj1: