Lineage for d1daob2 (1dao B:195-287)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30852Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)
  6. 30853Protein D-amino acid oxidase [54385] (2 species)
  7. 30854Species Pig (Sus scrofa) [TaxId:9823] [54386] (6 PDB entries)
  8. 30870Domain d1daob2: 1dao B:195-287 [37927]
    Other proteins in same PDB: d1daoa1, d1daob1, d1daoc1, d1daod1, d1daoe1, d1daof1, d1daog1, d1daoh1

Details for d1daob2

PDB Entry: 1dao (more details), 3.2 Å

PDB Description: covalent adduct of d-amino acid oxidase from pig kidney with 3-methyl-2-oxo-valeric acid

SCOP Domain Sequences for d1daob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1daob2 d.16.1.3 (B:195-287) D-amino acid oxidase {Pig (Sus scrofa)}
lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq
dhntiwegccrleptlkdakivgeytgfrpvrp

SCOP Domain Coordinates for d1daob2:

Click to download the PDB-style file with coordinates for d1daob2.
(The format of our PDB-style files is described here.)

Timeline for d1daob2: