SCOP 1.55: Domain d1daoh2: 1dao H:195-287

Lineage for d1daoh2 (1dao H:195-287)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)

5. Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)

6. Protein D-amino acid oxidase [54385] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [54386] (6 PDB entries)

8. Domain d1daoh2: 1dao H:195-287 [37933]
   Other proteins in same PDB: d1daoa1, d1daob1, d1daoc1, d1daod1, d1daoe1, d1daof1, d1daog1, d1daoh1

Details for d1daoh2

PDB Entry: 1dao, 3.2 Å

PDB Description: covalent adduct of d-amino acid oxidase from pig kidney with 3-methyl-2-oxo-valeric acid

SCOP Domain Sequences for d1daoh2:

Sequence; same for both SEQRES and ATOM records:

>d1daoh2 d.16.1.3 (H:195-287) D-amino acid oxidase {Pig (Sus scrofa)}
lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq
dhntiwegccrleptlkdakivgeytgfrpvrp

Timeline for d1daoh2:

• d1daoh2 appears in SCOP 1.57
  
• d1daoh2 appears in the current release, SCOPe 2.08