Lineage for d1daoe1 (1dao E:1-194,E:288-339)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21132Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 21133Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) (S)
  5. 21160Family c.4.1.2: D-amino acid oxidase, N-terminal domain [51979] (1 protein)
  6. 21161Protein D-amino acid oxidase, N-terminal domain [51980] (2 species)
  7. 21162Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)
  8. 21181Domain d1daoe1: 1dao E:1-194,E:288-339 [30643]
    Other proteins in same PDB: d1daoa2, d1daob2, d1daoc2, d1daod2, d1daoe2, d1daof2, d1daog2, d1daoh2

Details for d1daoe1

PDB Entry: 1dao (more details), 3.2 Å

PDB Description: covalent adduct of d-amino acid oxidase from pig kidney with 3-methyl-2-oxo-valeric acid
PDB Compounds: (E:)

SCOP Domain Sequences for d1daoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1daoe1 c.4.1.2 (E:1-194,E:288-339) D-amino acid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernl

SCOP Domain Coordinates for d1daoe1:

Click to download the PDB-style file with coordinates for d1daoe1.
(The format of our PDB-style files is described here.)

Timeline for d1daoe1: