Lineage for d6tskd5 (6tsk D:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781730Domain d6tskd5: 6tsk D:731-1023 [378887]
    Other proteins in same PDB: d6tska1, d6tska2, d6tska3, d6tska4, d6tskb1, d6tskb2, d6tskb3, d6tskb4, d6tskc1, d6tskc2, d6tskc3, d6tskc4, d6tskd1, d6tskd2, d6tskd3, d6tskd4
    automated match to d1jz8a4
    complexed with 0mk, mg

Details for d6tskd5

PDB Entry: 6tsk (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with l-ribose
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d6tskd5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tskd5 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d6tskd5:

Click to download the PDB-style file with coordinates for d6tskd5.
(The format of our PDB-style files is described here.)

Timeline for d6tskd5: