Lineage for d6tska3 (6tsk A:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830750Domain d6tska3: 6tsk A:334-625 [378857]
    Other proteins in same PDB: d6tska1, d6tska2, d6tska4, d6tska5, d6tskb1, d6tskb2, d6tskb4, d6tskb5, d6tskc1, d6tskc2, d6tskc4, d6tskc5, d6tskd1, d6tskd2, d6tskd4, d6tskd5
    automated match to d1jz7a5
    complexed with 0mk, mg

Details for d6tska3

PDB Entry: 6tsk (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with l-ribose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d6tska3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tska3 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6tska3:

Click to download the PDB-style file with coordinates for d6tska3.
(The format of our PDB-style files is described here.)

Timeline for d6tska3: