Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
Domain d6tskb4: 6tsk B:626-730 [378865] Other proteins in same PDB: d6tska1, d6tska3, d6tska5, d6tskb1, d6tskb3, d6tskb5, d6tskc1, d6tskc3, d6tskc5, d6tskd1, d6tskd3, d6tskd5 automated match to d1jz8a2 complexed with 0mk, mg |
PDB Entry: 6tsk (more details), 2.3 Å
SCOPe Domain Sequences for d6tskb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tskb4 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d6tskb4:
View in 3D Domains from same chain: (mouse over for more information) d6tskb1, d6tskb2, d6tskb3, d6tskb5 |