Lineage for d6tskc3 (6tsk C:334-625)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2417234Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2417318Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 3078794Species Human alphaherpesvirus 1 strain rh2 [TaxId:946522] [378856] (1 PDB entry)
  8. 3078845Domain d6tskc3: 6tsk C:334-625 [378907]
    Other proteins in same PDB: d6tska1, d6tska2, d6tska4, d6tska5, d6tskb1, d6tskb2, d6tskb4, d6tskb5, d6tskc1, d6tskc2, d6tskc4, d6tskc5, d6tskd1, d6tskd2, d6tskd4, d6tskd5
    automated match to d1jz7a5
    complexed with 0mk, mg

Details for d6tskc3

PDB Entry: 6tsk (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with l-ribose
PDB Compounds: (C:) LacZ protein

SCOPe Domain Sequences for d6tskc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tskc3 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Human alphaherpesvirus 1 strain rh2 [TaxId: 946522]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6tskc3:

Click to download the PDB-style file with coordinates for d6tskc3.
(The format of our PDB-style files is described here.)

Timeline for d6tskc3:

  • d6tskc3 is new in SCOPe 2.07-stable