Lineage for d6tskd2 (6tsk D:220-333)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2359630Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2359631Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2359632Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 3078792Species Human alphaherpesvirus 1 strain rh2 [TaxId:946522] [378854] (1 PDB entry)
  8. 3078822Domain d6tskd2: 6tsk D:220-333 [378884]
    Other proteins in same PDB: d6tska1, d6tska3, d6tska5, d6tskb1, d6tskb3, d6tskb5, d6tskc1, d6tskc3, d6tskc5, d6tskd1, d6tskd3, d6tskd5
    automated match to d1jz8a1
    complexed with 0mk, mg

Details for d6tskd2

PDB Entry: 6tsk (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with l-ribose
PDB Compounds: (D:) LacZ protein

SCOPe Domain Sequences for d6tskd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tskd2 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Human alphaherpesvirus 1 strain rh2 [TaxId: 946522]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d6tskd2:

Click to download the PDB-style file with coordinates for d6tskd2.
(The format of our PDB-style files is described here.)

Timeline for d6tskd2:

  • d6tskd2 is new in SCOPe 2.07-stable