Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
Domain d6tshc2: 6tsh C:220-333 [378874] Other proteins in same PDB: d6tsha1, d6tsha3, d6tsha5, d6tshb1, d6tshb3, d6tshb5, d6tshc1, d6tshc3, d6tshc5, d6tshd1, d6tshd3, d6tshd5 automated match to d1jz8a1 complexed with dgj, mg |
PDB Entry: 6tsh (more details), 2.3 Å
SCOPe Domain Sequences for d6tshc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tshc2 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d6tshc2:
View in 3D Domains from same chain: (mouse over for more information) d6tshc1, d6tshc3, d6tshc4, d6tshc5 |