PDB entry 6tsh

View 6tsh on RCSB PDB site
Description: Beta-galactosidase in complex with deoxygalacto-nojirimycin
Class: sugar binding protein
Keywords: Bgal, nojirimycin, SUGAR BINDING PROTEIN
Deposited on 2019-12-20, released 2020-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: EM
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6tshA (A:)
    mgsshhhhhhssglvprgshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseear
    tdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnv
    typitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygq
    dsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqis
    dfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderg
    gyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfrevrienglll
    lngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcd
    ryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesg
    hganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkw
    lslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikydengn
    pwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseyl
    frhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqp
    natawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsg
    flsqmwigdkkqlltplrdqftrapldndigvseatridpnawverwkaaghyqaeaall
    qctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdtphparig
    lncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtre
    lnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsv
    saefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tshA (A:)
    vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
    vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
    vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
    lrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcg
    elrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnl
    yravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmd
    eqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltd
    dprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyeg
    ggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslgg
    fakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvf
    adrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgev
    pldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsv
    tlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrap
    ldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgkt
    lfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypd
    rltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlm
    etshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6tshB (B:)
    mgsshhhhhhssglvprgshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseear
    tdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnv
    typitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygq
    dsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqis
    dfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderg
    gyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfrevrienglll
    lngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcd
    ryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesg
    hganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkw
    lslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikydengn
    pwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseyl
    frhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqp
    natawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsg
    flsqmwigdkkqlltplrdqftrapldndigvseatridpnawverwkaaghyqaeaall
    qctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdtphparig
    lncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtre
    lnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsv
    saefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tshB (B:)
    vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
    vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
    vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
    lrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcg
    elrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnl
    yravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmd
    eqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltd
    dprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyeg
    ggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslgg
    fakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvf
    adrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgev
    pldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsv
    tlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrap
    ldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgkt
    lfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypd
    rltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlm
    etshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6tshC (C:)
    mgsshhhhhhssglvprgshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseear
    tdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnv
    typitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygq
    dsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqis
    dfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderg
    gyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfrevrienglll
    lngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcd
    ryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesg
    hganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkw
    lslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikydengn
    pwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseyl
    frhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqp
    natawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsg
    flsqmwigdkkqlltplrdqftrapldndigvseatridpnawverwkaaghyqaeaall
    qctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdtphparig
    lncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtre
    lnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsv
    saefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tshC (C:)
    vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
    vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
    vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
    lrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcg
    elrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnl
    yravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmd
    eqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltd
    dprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyeg
    ggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslgg
    fakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvf
    adrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgev
    pldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsv
    tlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrap
    ldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgkt
    lfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypd
    rltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlm
    etshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6tshD (D:)
    mgsshhhhhhssglvprgshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseear
    tdrpsqqlrslngewrfawfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnv
    typitvnppfvptenptgcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygq
    dsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqis
    dfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderg
    gyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfrevrienglll
    lngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcd
    ryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesg
    hganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkw
    lslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikydengn
    pwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseyl
    frhsdnellhwmvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqp
    natawseaghisawqqwrlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsg
    flsqmwigdkkqlltplrdqftrapldndigvseatridpnawverwkaaghyqaeaall
    qctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdtphparig
    lncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtre
    lnygphqwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsv
    saefqlsagryhyqlvwcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tshD (D:)
    vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
    vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
    vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
    lrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcg
    elrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnl
    yravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmd
    eqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltd
    dprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyeg
    ggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslgg
    fakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvf
    adrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgev
    pldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsv
    tlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrap
    ldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgkt
    lfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypd
    rltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlm
    etshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk