Lineage for d6tshd1 (6tsh D:9-219)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2369723Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2369724Protein beta-Galactosidase [49804] (3 species)
  7. 2369732Species Escherichia coli [TaxId:562] [49805] (44 PDB entries)
    Uniprot P00722
  8. 3078816Domain d6tshd1: 6tsh D:9-219 [378878]
    Other proteins in same PDB: d6tsha2, d6tsha3, d6tsha4, d6tsha5, d6tshb2, d6tshb3, d6tshb4, d6tshb5, d6tshc2, d6tshc3, d6tshc4, d6tshc5, d6tshd2, d6tshd3, d6tshd4, d6tshd5
    automated match to d1f4ha3
    complexed with dgj, mg

Details for d6tshd1

PDB Entry: 6tsh (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with deoxygalacto-nojirimycin
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d6tshd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tshd1 b.18.1.5 (D:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6tshd1:

Click to download the PDB-style file with coordinates for d6tshd1.
(The format of our PDB-style files is described here.)

Timeline for d6tshd1:

  • d6tshd1 is new in SCOPe 2.07-stable