Lineage for d6tsha5 (6tsh A:731-1023)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2375752Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2375891Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2375892Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2375893Protein beta-Galactosidase, domain 5 [49996] (3 species)
  7. 2375901Species Escherichia coli [TaxId:562] [49997] (44 PDB entries)
    Uniprot P00722
  8. 3078810Domain d6tsha5: 6tsh A:731-1023 [378872]
    Other proteins in same PDB: d6tsha1, d6tsha2, d6tsha3, d6tsha4, d6tshb1, d6tshb2, d6tshb3, d6tshb4, d6tshc1, d6tshc2, d6tshc3, d6tshc4, d6tshd1, d6tshd2, d6tshd3, d6tshd4
    automated match to d1jz8a4
    complexed with dgj, mg

Details for d6tsha5

PDB Entry: 6tsh (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with deoxygalacto-nojirimycin
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d6tsha5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tsha5 b.30.5.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d6tsha5:

Click to download the PDB-style file with coordinates for d6tsha5.
(The format of our PDB-style files is described here.)

Timeline for d6tsha5:

  • d6tsha5 is new in SCOPe 2.07-stable