Lineage for d6tshb3 (6tsh B:334-625)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2417234Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2417318Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2417326Species Escherichia coli [TaxId:562] [51511] (44 PDB entries)
    Uniprot P00722
  8. 3078840Domain d6tshb3: 6tsh B:334-625 [378902]
    Other proteins in same PDB: d6tsha1, d6tsha2, d6tsha4, d6tsha5, d6tshb1, d6tshb2, d6tshb4, d6tshb5, d6tshc1, d6tshc2, d6tshc4, d6tshc5, d6tshd1, d6tshd2, d6tshd4, d6tshd5
    automated match to d1jz7a5
    complexed with dgj, mg

Details for d6tshb3

PDB Entry: 6tsh (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with deoxygalacto-nojirimycin
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6tshb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tshb3 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6tshb3:

Click to download the PDB-style file with coordinates for d6tshb3.
(The format of our PDB-style files is described here.)

Timeline for d6tshb3:

  • d6tshb3 is new in SCOPe 2.07-stable