Lineage for d6tsha1 (6tsh A:9-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774387Domain d6tsha1: 6tsh A:9-219 [378868]
    Other proteins in same PDB: d6tsha2, d6tsha3, d6tsha4, d6tsha5, d6tshb2, d6tshb3, d6tshb4, d6tshb5, d6tshc2, d6tshc3, d6tshc4, d6tshc5, d6tshd2, d6tshd3, d6tshd4, d6tshd5
    automated match to d1f4ha3
    complexed with dgj, mg

Details for d6tsha1

PDB Entry: 6tsh (more details), 2.3 Å

PDB Description: beta-galactosidase in complex with deoxygalacto-nojirimycin
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d6tsha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tsha1 b.18.1.5 (A:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6tsha1:

Click to download the PDB-style file with coordinates for d6tsha1.
(The format of our PDB-style files is described here.)

Timeline for d6tsha1: