SCOPe 2.07: Domain d6k13a1: 6k13 A:1-160

Lineage for d6k13a1 (6k13 A:1-160)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Babesia microti [TaxId:1133968] [375569] (3 PDB entries)

8. Domain d6k13a1: 6k13 A:1-160 [375570]
   Other proteins in same PDB: d6k13a2, d6k13b2, d6k13b3
   automated match to d4jnka1
   complexed with nad, oxm

Details for d6k13a1

PDB Entry: 6k13, 1.89 Å

PDB Description: crystal structure basis for bmldh complex

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6k13a1:

Sequence; same for both SEQRES and ATOM records:

>d6k13a1 c.2.1.0 (A:1-160) automated matches {Babesia microti [TaxId: 1133968]}
mhslkeeflirltnedlnasnkitvigvgavgmacafsilnkeladelvlidvvedklkg
emmdlqqgslflktpniiagkdyeltansklvvvtagarqqegesrlnlvqrnvnifkfi
ipnvvkyspdcillivsnpvdiltyvawklsgfplnrvig

Timeline for d6k13a1:

• d6k13a1 is new in SCOPe 2.07-stable
  
• d6k13a1 appears in the current release, SCOPe 2.08