PDB entry 6k13

View 6k13 on RCSB PDB site
Description: Crystal Structure Basis for BmLDH Complex
Class: oxidoreductase
Keywords: Babesia microti lactate dehydrogenase, Glycolysis, Lactate dehydrogenase, OXIDOREDUCTASE
Deposited on 2019-05-09, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Babesia microti (strain RI) [TaxId:1133968]
    Gene: BMR1_01G00020
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k13a1, d6k13a2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Babesia microti (strain RI) [TaxId:1133968]
    Gene: BMR1_01G00020
    Database cross-references and differences (RAF-indexed):
    • Uniprot I7J7V6 (1-332)
      • expression tag (0)
    Domains in SCOPe 2.07: d6k13b1, d6k13b2, d6k13b3
  • Heterogens: NAD, OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6k13A (A:)
    smhslkeeflirltnedlnasnkitvigvgavgmacafsilnkeladelvlidvvedklk
    gemmdlqqgslflktpniiagkdyeltansklvvvtagarqqegesrlnlvqrnvnifkf
    iipnvvkyspdcillivsnpvdiltyvawklsgfplnrvigsgcnldsarfrylvsemig
    ihpsnfhgcilgehgdssvpilsglniagmsiknlhtdidtvfikdmckdvhkkvtesay
    eiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgqfgidnevflsvpcvlgrng
    isevfkpkltveeeqqlknsaetiwntqkdiql
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k13A (A:)
    mhslkeeflirltnedlnasnkitvigvgavgmacafsilnkeladelvlidvvedklkg
    emmdlqqgslflktpniiagkdyeltansklvvvtagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspdcillivsnpvdiltyvawklsgfplnrvigsgcnldsarfrylvsemigi
    hpsnfhgcilgehgdssvpilsglniagmsiknlhtdidtvfikdmckdvhkkvtesaye
    iiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgqfgidnevflsvpcvlgrngi
    sevfkpkltveeeqqlknsaetiwntqkdiql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6k13B (B:)
    smhslkeeflirltnedlnasnkitvigvgavgmacafsilnkeladelvlidvvedklk
    gemmdlqqgslflktpniiagkdyeltansklvvvtagarqqegesrlnlvqrnvnifkf
    iipnvvkyspdcillivsnpvdiltyvawklsgfplnrvigsgcnldsarfrylvsemig
    ihpsnfhgcilgehgdssvpilsglniagmsiknlhtdidtvfikdmckdvhkkvtesay
    eiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgqfgidnevflsvpcvlgrng
    isevfkpkltveeeqqlknsaetiwntqkdiql
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k13B (B:)
    smhslkeeflirltnedlnasnkitvigvgavgmacafsilnkeladelvlidvvedklk
    gemmdlqqgslflktpniiagkdyeltansklvvvtagarqqegesrlnlvqrnvnifkf
    iipnvvkyspdcillivsnpvdiltyvawklsgfplnrvigsgcnldsarfrylvsemig
    ihpsnfhgcilgehgdssvpilsglniagmsiknldmckdvhkkvtesayeiiklkgyts
    waiglsvgdlscsliknlrkvhpvstlvkgqfgidnevflsvpcvlgrngisevfkpklt
    veeeqqlknsaetiwntqkdiql