Lineage for d6k13b1 (6k13 B:1-160)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454367Species Babesia microti [TaxId:1133968] [375569] (3 PDB entries)
  8. 2454369Domain d6k13b1: 6k13 B:1-160 [375596]
    Other proteins in same PDB: d6k13a2, d6k13b2, d6k13b3
    automated match to d4jnka1
    complexed with nad, oxm

Details for d6k13b1

PDB Entry: 6k13 (more details), 1.89 Å

PDB Description: crystal structure basis for bmldh complex
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6k13b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k13b1 c.2.1.0 (B:1-160) automated matches {Babesia microti [TaxId: 1133968]}
mhslkeeflirltnedlnasnkitvigvgavgmacafsilnkeladelvlidvvedklkg
emmdlqqgslflktpniiagkdyeltansklvvvtagarqqegesrlnlvqrnvnifkfi
ipnvvkyspdcillivsnpvdiltyvawklsgfplnrvig

SCOPe Domain Coordinates for d6k13b1:

Click to download the PDB-style file with coordinates for d6k13b1.
(The format of our PDB-style files is described here.)

Timeline for d6k13b1: