![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
![]() | Protein automated matches [226850] (47 species) not a true protein |
![]() | Species Babesia microti [TaxId:1133968] [375571] (3 PDB entries) |
![]() | Domain d6k13a2: 6k13 A:161-332 [375572] Other proteins in same PDB: d6k13a1, d6k13b1, d6k13b3 automated match to d4jnka2 complexed with nad, oxm |
PDB Entry: 6k13 (more details), 1.89 Å
SCOPe Domain Sequences for d6k13a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k13a2 d.162.1.0 (A:161-332) automated matches {Babesia microti [TaxId: 1133968]} sgcnldsarfrylvsemigihpsnfhgcilgehgdssvpilsglniagmsiknlhtdidt vfikdmckdvhkkvtesayeiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgq fgidnevflsvpcvlgrngisevfkpkltveeeqqlknsaetiwntqkdiql
Timeline for d6k13a2: