SCOPe 2.07: Domain d6k13b2: 6k13 B:161-332

Lineage for d6k13b2 (6k13 B:161-332)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Babesia microti [TaxId:1133968] [375571] (3 PDB entries)

8. Domain d6k13b2: 6k13 B:161-332 [375597]
   Other proteins in same PDB: d6k13a1, d6k13b1, d6k13b3
   automated match to d4jnka2
   complexed with nad, oxm

Details for d6k13b2

PDB Entry: 6k13, 1.89 Å

PDB Description: crystal structure basis for bmldh complex

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6k13b2:

Sequence, based on SEQRES records:

>d6k13b2 d.162.1.0 (B:161-332) automated matches {Babesia microti [TaxId: 1133968]}
sgcnldsarfrylvsemigihpsnfhgcilgehgdssvpilsglniagmsiknlhtdidt
vfikdmckdvhkkvtesayeiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgq
fgidnevflsvpcvlgrngisevfkpkltveeeqqlknsaetiwntqkdiql

Sequence, based on observed residues (ATOM records):

>d6k13b2 d.162.1.0 (B:161-332) automated matches {Babesia microti [TaxId: 1133968]}
sgcnldsarfrylvsemigihpsnfhgcilgehgdssvpilsglniagmsiknldmckdv
hkkvtesayeiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgqfgidnevfls
vpcvlgrngisevfkpkltveeeqqlknsaetiwntqkdiql

Timeline for d6k13b2:

• d6k13b2 is new in SCOPe 2.07-stable
  
• d6k13b2 appears in the current release, SCOPe 2.08