Lineage for d6k13b2 (6k13 B:161-332)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2605462Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2605463Protein automated matches [226850] (47 species)
    not a true protein
  7. 2605485Species Babesia microti [TaxId:1133968] [375571] (3 PDB entries)
  8. 2605487Domain d6k13b2: 6k13 B:161-332 [375597]
    Other proteins in same PDB: d6k13a1, d6k13b1, d6k13b3
    automated match to d4jnka2
    complexed with nad, oxm

Details for d6k13b2

PDB Entry: 6k13 (more details), 1.89 Å

PDB Description: crystal structure basis for bmldh complex
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6k13b2:

Sequence, based on SEQRES records: (download)

>d6k13b2 d.162.1.0 (B:161-332) automated matches {Babesia microti [TaxId: 1133968]}
sgcnldsarfrylvsemigihpsnfhgcilgehgdssvpilsglniagmsiknlhtdidt
vfikdmckdvhkkvtesayeiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgq
fgidnevflsvpcvlgrngisevfkpkltveeeqqlknsaetiwntqkdiql

Sequence, based on observed residues (ATOM records): (download)

>d6k13b2 d.162.1.0 (B:161-332) automated matches {Babesia microti [TaxId: 1133968]}
sgcnldsarfrylvsemigihpsnfhgcilgehgdssvpilsglniagmsiknldmckdv
hkkvtesayeiiklkgytswaiglsvgdlscsliknlrkvhpvstlvkgqfgidnevfls
vpcvlgrngisevfkpkltveeeqqlknsaetiwntqkdiql

SCOPe Domain Coordinates for d6k13b2:

Click to download the PDB-style file with coordinates for d6k13b2.
(The format of our PDB-style files is described here.)

Timeline for d6k13b2: