SCOP 1.55: Domain d1icf.1: 1icf A:,B:

Lineage for d1icf.1 (1icf A:,B:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)

4. Superfamily d.3.1: Cysteine proteinases [54001] (7 families)

5. Family d.3.1.1: Papain-like [54002] (15 proteins)

6. Protein (Pro)cathepsin L [54026] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54027] (3 PDB entries)

8. Domain d1icf.1: 1icf A:,B: [37067]
   Other proteins in same PDB: d1icfi_, d1icfj_

Details for d1icf.1

PDB Entry: 1icf, 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l

SCOP Domain Sequences for d1icf.1:

Sequence; same for both SEQRES and ATOM records:

>g1icf.1 d.3.1.1 (A:,B:) (Pro)cathepsin L {Human (Homo sapiens)}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestXnnky
wlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Timeline for d1icf.1:

• d1icf.1 appears in SCOP 1.57
  
• d1icf.1 appears in the current release, SCOPe 2.08