Lineage for d1icfj_ (1icf J:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41131Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
  4. 41132Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family) (S)
  5. 41133Family g.28.1.1: Thyroglobulin type-1 domain [57611] (1 protein)
  6. 41134Protein MHC class II associated p41 invariant chain fragment [57612] (1 species)
  7. 41135Species Human (Homo sapiens) [TaxId:9606] [57613] (1 PDB entry)
  8. 41137Domain d1icfj_: 1icf J: [44959]
    Other proteins in same PDB: d1icf.1, d1icf.2

Details for d1icfj_

PDB Entry: 1icf (more details), 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l

SCOP Domain Sequences for d1icfj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icfj_ g.28.1.1 (J:) MHC class II associated p41 invariant chain fragment {Human (Homo sapiens)}
ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
ncses

SCOP Domain Coordinates for d1icfj_:

Click to download the PDB-style file with coordinates for d1icfj_.
(The format of our PDB-style files is described here.)

Timeline for d1icfj_: