SCOP 1.55: Domain d1icfi_: 1icf I:

Lineage for d1icfi_ (1icf I:)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)

4. Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family)

5. Family g.28.1.1: Thyroglobulin type-1 domain [57611] (1 protein)

6. Protein MHC class II associated p41 invariant chain fragment [57612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57613] (1 PDB entry)

8. Domain d1icfi_: 1icf I: [44958]
   Other proteins in same PDB: d1icf.1, d1icf.2

Details for d1icfi_

PDB Entry: 1icf, 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l

SCOP Domain Sequences for d1icfi_:

Sequence; same for both SEQRES and ATOM records:

>d1icfi_ g.28.1.1 (I:) MHC class II associated p41 invariant chain fragment {Human (Homo sapiens)}
ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
ncses

Timeline for d1icfi_:

• d1icfi_ appears in SCOP 1.57
  
• d1icfi_ appears in the current release, SCOPe 2.08