SCOP 1.55: Domain d1huc.1: 1huc A:,B:

Lineage for d1huc.1 (1huc A:,B:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)

4. Superfamily d.3.1: Cysteine proteinases [54001] (7 families)

5. Family d.3.1.1: Papain-like [54002] (15 proteins)

6. Protein (Pro)cathepsin B [54022] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54023] (5 PDB entries)

8. Domain d1huc.1: 1huc A:,B: [37049]

Details for d1huc.1

PDB Entry: 1huc, 2.1 Å

PDB Description: the refined 2.15 angstroms x-ray crystal structure of human liver cathepsin b: the structural basis for its specificity

SCOP Domain Sequences for d1huc.1:

Sequence; same for both SEQRES and ATOM records:

>g1huc.1 d.3.1.1 (A:,B:) (Pro)cathepsin B {Human (Homo sapiens)}
lpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnXvsvevsaedllt
ccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrppctg
egdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvysdfl
lyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhcg
iesevvagiprtd

Timeline for d1huc.1:

• d1huc.1 appears in SCOP 1.57
  
• d1huc.1 appears in the current release, SCOPe 2.08