SCOPe 2.08: Domain d1huc.1: 1huc A:,B:

Lineage for d1huc.1 (1huc A:,B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin B [54022] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54023] (6 PDB entries)

8. Domain d1huc.1: 1huc A:,B: [37049]

Details for d1huc.1

PDB Entry: 1huc, 2.1 Å

PDB Description: the refined 2.15 angstroms x-ray crystal structure of human liver cathepsin b: the structural basis for its specificity

PDB Compounds: (A:) cathepsin b, (B:) cathepsin b

SCOPe Domain Sequences for d1huc.1:

Sequence; same for both SEQRES and ATOM records:

>g1huc.1 d.3.1.1 (A:,B:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]}
lpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnXvsvevsaedllt
ccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrppctg
egdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvysdfl
lyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhcg
iesevvagiprtd

Timeline for d1huc.1:

• d1huc.1 first appeared (with stable ids) in SCOP 1.55
  
• d1huc.1 appears in SCOPe 2.07