Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) |
Superfamily d.3.1: Cysteine proteinases [54001] (7 families) |
Family d.3.1.1: Papain-like [54002] (16 proteins) |
Protein (Pro)cathepsin B [54022] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54023] (5 PDB entries) |
Domain d1huc.1: 1huc A:,B: [37049] |
PDB Entry: 1huc (more details), 2.1 Å
SCOP Domain Sequences for d1huc.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1huc.1 d.3.1.1 (A:,B:) (Pro)cathepsin B {Human (Homo sapiens)} lpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtnXvsvevsaedllt ccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippcehhvngsrppctg egdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngpvegafsvysdfl lyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdngffkilrgqdhcg iesevvagiprtd
Timeline for d1huc.1:
View in 3D Domains from other chains: (mouse over for more information) d1huc.2, d1huc.2, d1huc.2, d1huc.2 |