SCOPe 2.08: Domain d6gkda_: 6gkd A:

Lineage for d6gkda_ (6gkd A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
   Uniprot P13569 389-671

8. Domain d6gkda_: 6gkd A: [369975]
   Other proteins in same PDB: d6gkdb1, d6gkdb2, d6gkdc1, d6gkdc2, d6gkdg1, d6gkdg2, d6gkdh1, d6gkdh2, d6gkdj1, d6gkdj2, d6gkdk1, d6gkdk2, d6gkdm1, d6gkdm2, d6gkdn1, d6gkdn2, d6gkdp1, d6gkdp2, d6gkdq1, d6gkdq2, d6gkds1, d6gkds2, d6gkdt1, d6gkdt2
   automated match to d2pzga_
   complexed with atp, gol, mg

Details for d6gkda_

PDB Entry: 6gkd, 2.99 Å

PDB Description: human nbd1 of cftr in complex with nanobodies d12 and g3a

PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d6gkda_:

Sequence; same for both SEQRES and ATOM records:

>d6gkda_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepseg
kikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdniv
lgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktr
ilvtskmehlkkadkililhegssyfygtfselqnl

Timeline for d6gkda_:

• d6gkda_ first appeared in SCOPe 2.07