Lineage for d2pzga_ (2pzg A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
    Uniprot P13569 389-671
  8. Domain d2pzga_: 2pzg A: [231181]
    automated match to d2pzgb_
    complexed with atp, gol, mg

Details for d2pzga_

PDB Entry: 2pzg (more details), 1.8 Å

PDB Description: minimal human cftr first nucleotide binding domain as a monomer
PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d2pzga_:

Sequence, based on SEQRES records: (download)

>d2pzga_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
tevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepsegk
ikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivl
geggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
lvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmg

Sequence, based on observed residues (ATOM records): (download)

>d2pzga_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
tevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepsegk
ikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivl
geggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
lvtskmehlkkadkililhegssyfygtfselqnpdfssklmg

SCOPe Domain Coordinates for d2pzga_ are not available.

Timeline for d2pzga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pzgb_