SCOPe 2.08: Domain d6gkds1: 6gkd S:6-123

Lineage for d6gkds1 (6gkd S:6-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d6gkds1: 6gkd S:6-123 [369902]
   Other proteins in same PDB: d6gkda_, d6gkdb2, d6gkdc2, d6gkdf_, d6gkdg2, d6gkdh2, d6gkdi_, d6gkdj2, d6gkdk2, d6gkdl_, d6gkdm2, d6gkdn2, d6gkdo_, d6gkdp2, d6gkdq2, d6gkdr_, d6gkds2, d6gkdt2
   automated match to d4nbzb_
   complexed with atp, gol, mg

Details for d6gkds1

PDB Entry: 6gkd, 2.99 Å

PDB Description: human nbd1 of cftr in complex with nanobodies d12 and g3a

PDB Compounds: (S:) Nanobody D12

SCOPe Domain Sequences for d6gkds1:

Sequence; same for both SEQRES and ATOM records:

>d6gkds1 b.1.1.0 (S:6-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqagsslrlacaatgsirsinnmgwyrqapgkqrgmvaiitrvgntdyadsvkg
rftisrdnakntvylqmnslkpedtatyychaeiteqsrpfyltddywgqgtqvtvss

Timeline for d6gkds1:

• d6gkds1 first appeared in SCOPe 2.07