SCOPe 2.08: Domain d6n3pi1: 6n3p I:1-75

Lineage for d6n3pi1 (6n3p I:1-75)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [366041] (1 PDB entry)

8. Domain d6n3pi1: 6n3p I:1-75 [366056]
   Other proteins in same PDB: d6n3pa_, d6n3pb_, d6n3pc_, d6n3pd_, d6n3pe_, d6n3pf_, d6n3pi2, d6n3pk2
   automated match to d2lola_
   complexed with xln

Details for d6n3pi1

PDB Entry: 6n3p, 2.5 Å

PDB Description: crosslinked acpp=fabz complex from e. coli type ii fas

PDB Compounds: (I:) Acyl carrier protein

SCOPe Domain Sequences for d6n3pi1:

Sequence; same for both SEQRES and ATOM records:

>d6n3pi1 a.28.1.0 (I:1-75) automated matches {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyingh

Timeline for d6n3pi1:

• d6n3pi1 first appeared in SCOPe 2.07