Lineage for d6n3pi1 (6n3p I:1-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706266Species Escherichia coli [TaxId:562] [366041] (1 PDB entry)
  8. 2706269Domain d6n3pi1: 6n3p I:1-75 [366056]
    Other proteins in same PDB: d6n3pa_, d6n3pb_, d6n3pc_, d6n3pd_, d6n3pe_, d6n3pf_, d6n3pi2, d6n3pk2
    automated match to d2lola_
    complexed with xln

Details for d6n3pi1

PDB Entry: 6n3p (more details), 2.5 Å

PDB Description: crosslinked acpp=fabz complex from e. coli type ii fas
PDB Compounds: (I:) Acyl carrier protein

SCOPe Domain Sequences for d6n3pi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n3pi1 a.28.1.0 (I:1-75) automated matches {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyingh

SCOPe Domain Coordinates for d6n3pi1:

Click to download the PDB-style file with coordinates for d6n3pi1.
(The format of our PDB-style files is described here.)

Timeline for d6n3pi1: