Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Escherichia coli [TaxId:562] [366036] (1 PDB entry) |
Domain d6n3pe_: 6n3p E: [366037] Other proteins in same PDB: d6n3pg_, d6n3ph_, d6n3pi1, d6n3pi2, d6n3pj_, d6n3pk1, d6n3pk2, d6n3pl_ automated match to d5buwa_ complexed with xln |
PDB Entry: 6n3p (more details), 2.5 Å
SCOPe Domain Sequences for d6n3pe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n3pe_ d.38.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]} thtlqieeilellphrfpfllvdrvldfeegrflravknvsvnepffqghfpgkpifpgv lileamaqatgilafksvgklepgelyyfagidearfkrpvvpgdqmimevtfektrrgl trfkgvalvdgkvvceatmmcarsre
Timeline for d6n3pe_: