Lineage for d6n3pc_ (6n3p C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944391Species Escherichia coli [TaxId:562] [366036] (1 PDB entry)
  8. 2944394Domain d6n3pc_: 6n3p C: [366048]
    Other proteins in same PDB: d6n3pg_, d6n3ph_, d6n3pi1, d6n3pi2, d6n3pj_, d6n3pk1, d6n3pk2, d6n3pl_
    automated match to d5buwa_
    complexed with xln

Details for d6n3pc_

PDB Entry: 6n3p (more details), 2.5 Å

PDB Description: crosslinked acpp=fabz complex from e. coli type ii fas
PDB Compounds: (C:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

SCOPe Domain Sequences for d6n3pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n3pc_ d.38.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
thtlqieeilellphrfpfllvdrvldfeegrflravknvsvnepffqghfpgkpifpgv
lileamaqatgilafksvgklepgelyyfagidearfkrpvvpgdqmimevtfektrrgl
trfkgvalvdgkvvceatmmcars

SCOPe Domain Coordinates for d6n3pc_:

Click to download the PDB-style file with coordinates for d6n3pc_.
(The format of our PDB-style files is described here.)

Timeline for d6n3pc_: