Lineage for d5buwa_ (5buw A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) 
Family d.38.1.0: automated matches [191325] (1 protein)
not a true familyProtein automated matches [190143] (42 species)
not a true protein
Species Yersinia pestis [TaxId:632] [257672] (3 PDB entries) 
Domain d5buwa_: 5buw A: [318423]
automated match to d4h4ge_
complexed with edo, scn
Details for d5buwa_
PDB Entry: 5buw (more details), 1.8 Å
PDB Description: crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from yersinia pestis
PDB Compounds: (A:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZSCOPe Domain Sequences for d5buwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5buwa_ d.38.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
thtlhieeildllphrfpfllvdrvldfeegkflravknvsfnepffqghfpgkpifpgv
lileamaqatgilafksrgklepgelyyfagidearfkrpvvpgdqmimevefvkerrgl
trftgvakvdgeivctatmmcars
SCOPe Domain Coordinates for d5buwa_:
Click to download the PDB-style file with coordinates for d5buwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5buwa_:
- d5buwa_ first appeared in SCOPe 2.06
- d5buwa_ appears in SCOPe 2.07
View in 3D
