Lineage for d2lola_ (2lol A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706325Species Rickettsia prowazekii [TaxId:272947] [255452] (1 PDB entry)
  8. 2706326Domain d2lola_: 2lol A: [242950]
    automated match to d3gzma_

Details for d2lola_

PDB Entry: 2lol (more details)

PDB Description: NMR structure of an acyl-carrier protein from Rickettsia prowazekii, Seattle Structural Genomics Center for Infectious Disease (SSGCID)
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2lola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lola_ a.28.1.0 (A:) automated matches {Rickettsia prowazekii [TaxId: 272947]}
msttdkieqkviemvaeklnkdkaiittdsrfiedlkadsldtvelmmaieveygidipd
deatkiktvsdvikyikerqs

SCOPe Domain Coordinates for d2lola_:

Click to download the PDB-style file with coordinates for d2lola_.
(The format of our PDB-style files is described here.)

Timeline for d2lola_: