Lineage for d6id0c5 (6id0 C:829-943)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560339Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2560433Family d.58.11.0: automated matches [254210] (1 protein)
    not a true family
  6. 2560434Protein automated matches [254469] (4 species)
    not a true protein
  7. 2560458Species Homo sapiens [TaxId:9606] [365902] (3 PDB entries)
  8. 2560462Domain d6id0c5: 6id0 C:829-943 [365905]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c4, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_
    automated match to d3jb9b4

Details for d6id0c5

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id0c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0c5 d.58.11.0 (C:829-943) automated matches {Homo sapiens [TaxId: 9606]}
epyyfvevqapadcvsavytvlarrrghvtqdapipgsplytikafipaidsfgfetdlr
thtqgqafslsvfhhwqivpgdpldksivirplepqpaphlarefmiktrrrkgl

SCOPe Domain Coordinates for d6id0c5:

Click to download the PDB-style file with coordinates for d6id0c5.
(The format of our PDB-style files is described here.)

Timeline for d6id0c5: