Lineage for d6id0c4 (6id0 C:660-828)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538179Species Human (Homo sapiens) [TaxId:9606] [189350] (12 PDB entries)
  8. 2538216Domain d6id0c4: 6id0 C:660-828 [365904]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_
    automated match to d3jb9b5
    complexed with gtp, i6p, mg, zn

Details for d6id0c4

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id0c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0c4 d.14.1.0 (C:660-828) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtfcetvvetsslkcfaetpnkknkitmiaeplekglaedienevvqitwnrkklgeffq
tkydwdllaarsiwafgpdatgpnilvddtlpsevdkallgsvkdsivqgfqwgtregpl
cdelirnvkfkildavvaqeplhrgggqiiptarrvvysaflmatprlm

SCOPe Domain Coordinates for d6id0c4:

Click to download the PDB-style file with coordinates for d6id0c4.
(The format of our PDB-style files is described here.)

Timeline for d6id0c4: