Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189350] (12 PDB entries) |
Domain d6id0c4: 6id0 C:660-828 [365904] Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_ automated match to d3jb9b5 complexed with gtp, i6p, mg, zn |
PDB Entry: 6id0 (more details), 2.9 Å
SCOPe Domain Sequences for d6id0c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id0c4 d.14.1.0 (C:660-828) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtfcetvvetsslkcfaetpnkknkitmiaeplekglaedienevvqitwnrkklgeffq tkydwdllaarsiwafgpdatgpnilvddtlpsevdkallgsvkdsivqgfqwgtregpl cdelirnvkfkildavvaqeplhrgggqiiptarrvvysaflmatprlm
Timeline for d6id0c4:
View in 3D Domains from same chain: (mouse over for more information) d6id0c1, d6id0c2, d6id0c3, d6id0c5 |