Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries) |
Domain d6id0c1: 6id0 C:56-439 [365899] Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_ automated match to d3jb9b1 complexed with gtp, i6p, mg, zn |
PDB Entry: 6id0 (more details), 2.9 Å
SCOPe Domain Sequences for d6id0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id0c1 c.37.1.0 (C:56-439) automated matches {Human (Homo sapiens) [TaxId: 9606]} evvlhedkkyyptaeevygpevetivqeedtqpltepiikpvktkkftlmeqtlpvtvye mdfladlmdnselirnvtlcghlhhgktcfvdclieqthpeirkrydqdlcytdilfteq ergvgikstpvtvvlpdtkgksylfnimdtpghvnfsdevtaglrisdgvvlfidaaegv mlnterlikhavqerlavtvcinkidrlilelklpptdayyklrhivdevnglismystd enlilspllgnvcfsssqysicftlgsfakiyadtfgdinyqefakrlwgdiyfnpktrk ftkkaptsssqrsfvefileplykilaqvvgdvdtslprtldelgihltkeelklnirpl lrlvckkffgeftgfvdmcvqhip
Timeline for d6id0c1:
View in 3D Domains from same chain: (mouse over for more information) d6id0c2, d6id0c3, d6id0c4, d6id0c5 |