Lineage for d6id0c1 (6id0 C:56-439)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480081Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)
  8. 2480409Domain d6id0c1: 6id0 C:56-439 [365899]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_
    automated match to d3jb9b1
    complexed with gtp, i6p, mg, zn

Details for d6id0c1

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0c1 c.37.1.0 (C:56-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlhedkkyyptaeevygpevetivqeedtqpltepiikpvktkkftlmeqtlpvtvye
mdfladlmdnselirnvtlcghlhhgktcfvdclieqthpeirkrydqdlcytdilfteq
ergvgikstpvtvvlpdtkgksylfnimdtpghvnfsdevtaglrisdgvvlfidaaegv
mlnterlikhavqerlavtvcinkidrlilelklpptdayyklrhivdevnglismystd
enlilspllgnvcfsssqysicftlgsfakiyadtfgdinyqefakrlwgdiyfnpktrk
ftkkaptsssqrsfvefileplykilaqvvgdvdtslprtldelgihltkeelklnirpl
lrlvckkffgeftgfvdmcvqhip

SCOPe Domain Coordinates for d6id0c1:

Click to download the PDB-style file with coordinates for d6id0c1.
(The format of our PDB-style files is described here.)

Timeline for d6id0c1: