Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.4: U2A'-like [52068] (2 proteins) duplication: consists of 5-6 partly irregular repeats this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain |
Protein automated matches [365867] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [365868] (3 PDB entries) |
Domain d6id0o_: 6id0 o: [365889] Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_ automated match to d1a9nc_ complexed with gtp, i6p, mg, zn |
PDB Entry: 6id0 (more details), 2.9 Å
SCOPe Domain Sequences for d6id0o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id0o_ c.10.2.4 (o:) automated matches {Homo sapiens [TaxId: 9606]} vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp llrrlktllvnnnricrigegldqalpclteliltnnslvelgdldplaslksltylsil rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk
Timeline for d6id0o_:
View in 3D Domains from other chains: (mouse over for more information) d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_ |