Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries) |
Domain d6hrdd1: 6hrd D:3-189 [362727] Other proteins in same PDB: d6hrda2, d6hrda3, d6hrdb2, d6hrdb3, d6hrdc2, d6hrdc3, d6hrdd2, d6hrdd3, d6hrde2, d6hrde3, d6hrdf2, d6hrdf3 automated match to d2hdha2 complexed with gol |
PDB Entry: 6hrd (more details), 2.11 Å
SCOPe Domain Sequences for d6hrdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hrdd1 c.2.1.0 (D:3-189) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} daiqrvgvvgagqmgsgiaevsaragvevtvfepaealitagrnrivksleravsagkvt ererdralglltfttdlndlsdrqlvieavvedeavkseifaeldrvvtdpdavlasnts sipimkvaaatkqpqrvlglhffnpvpvlplvelvrtlvtdeaaaarteefastvlgkqv vrcsdrs
Timeline for d6hrdd1: