Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [354674] (11 PDB entries) |
Domain d6hrda2: 6hrd A:190-286 [362725] Other proteins in same PDB: d6hrda1, d6hrda3, d6hrdb1, d6hrdb3, d6hrdc1, d6hrdc3, d6hrdd1, d6hrdd3, d6hrde1, d6hrde3, d6hrdf1, d6hrdf3 automated match to d2hdha1 complexed with gol |
PDB Entry: 6hrd (more details), 2.11 Å
SCOPe Domain Sequences for d6hrda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hrda2 a.100.1.0 (A:190-286) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} gfvvnallvpyllsairmveagfatvedvdkavvaglshpmgplrlsdlvgldtlkliad kmfeefkephygppplllrmveagqlgkksgrgfyty
Timeline for d6hrda2: