Lineage for d6hrdc1 (6hrd C:3-189)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847786Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries)
  8. 2847818Domain d6hrdc1: 6hrd C:3-189 [362717]
    Other proteins in same PDB: d6hrda2, d6hrda3, d6hrdb2, d6hrdb3, d6hrdc2, d6hrdc3, d6hrdd2, d6hrdd3, d6hrde2, d6hrde3, d6hrdf2, d6hrdf3
    automated match to d2hdha2
    complexed with gol

Details for d6hrdc1

PDB Entry: 6hrd (more details), 2.11 Å

PDB Description: crystal structure of m. tuberculosis fadb2 (rv0468)
PDB Compounds: (C:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6hrdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hrdc1 c.2.1.0 (C:3-189) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
daiqrvgvvgagqmgsgiaevsaragvevtvfepaealitagrnrivksleravsagkvt
ererdralglltfttdlndlsdrqlvieavvedeavkseifaeldrvvtdpdavlasnts
sipimkvaaatkqpqrvlglhffnpvpvlplvelvrtlvtdeaaaarteefastvlgkqv
vrcsdrs

SCOPe Domain Coordinates for d6hrdc1:

Click to download the PDB-style file with coordinates for d6hrdc1.
(The format of our PDB-style files is described here.)

Timeline for d6hrdc1: