SCOPe 2.08: Domain d6hrde2: 6hrd E:190-286

Lineage for d6hrde2 (6hrd E:190-286)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [354674] (11 PDB entries)

8. Domain d6hrde2: 6hrd E:190-286 [362833]
   Other proteins in same PDB: d6hrda1, d6hrda3, d6hrdb1, d6hrdb3, d6hrdc1, d6hrdc3, d6hrdd1, d6hrdd3, d6hrde1, d6hrde3, d6hrdf1, d6hrdf3
   automated match to d2hdha1
   complexed with gol

Details for d6hrde2

PDB Entry: 6hrd, 2.11 Å

PDB Description: crystal structure of m. tuberculosis fadb2 (rv0468)

PDB Compounds: (E:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d6hrde2:

Sequence; same for both SEQRES and ATOM records:

>d6hrde2 a.100.1.0 (E:190-286) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gfvvnallvpyllsairmveagfatvedvdkavvaglshpmgplrlsdlvgldtlkliad
kmfeefkephygppplllrmveagqlgkksgrgfyty

Timeline for d6hrde2:

• d6hrde2 first appeared in SCOPe 2.07