Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.3: Porins [56935] (5 families) |
Family f.4.3.0: automated matches [267625] (1 protein) not a true family |
Protein automated matches [267676] (11 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [317226] (4 PDB entries) |
Domain d6hcpb_: 6hcp B: [358608] automated match to d5fp1a_ complexed with c8e, edo, po4 |
PDB Entry: 6hcp (more details), 1.83 Å
SCOPe Domain Sequences for d6hcpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hcpb_ f.4.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]} dtyaggqvatssnvgflgskkfldtpfntisytdkyiedkqakditeviaatdpsiytng asggwsenyyirgyasstndmsmnglfgitpfyrtspemfgrvevlkgpsallngmppag svggtvnlvtkyaadepfarltttymsdaqfgghvdvgrrfgenkefgvringmyrdgda avndqskesrlfslgldwqgenarvfvdaydaldhvdgvtrgvnvstavgipkppkadtl lspdwgsvetkdkgamirgeydfsdqlmayaaygqstteykyngasagtitsstgtlsst lgqlafdvdkksadagfkgkfetgsvkhqwvanatyynhtqddygyriipgfsdpvitni ydpnpnwgpkpeftppflfhstlstssfgladtlsfaqdkvqltlglrhqtvkatssvnt lpenaksattpgvallikatdkisvyanyiegltkgdqapatasnpgeifppqktkqqel glkvdlgtfahtlsafeitkpssyldpsklvnnlptfvsdgeqrnrgiewsffgspiehv rlmggftyldpeltktksggndghtavavpknqaklgaewdtqvaqgtltlsgninavsk qyinaentlsvpgrtlldvgarystkvedhpvtfraniynltnkaywaqpqltnlalgap rtymlsvsydf
Timeline for d6hcpb_: